(data stored in ACNUC10043 zone)

EMBL: AP011532.PE51

AP011532.PE51        Location/Qualifiers
FT   CDS             39370..39618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60123"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUK1"
FT                   /protein_id="BAI60123.1"
FT                   /translation="MLANYIVDKHKELQFNVPDVTIKRDDDNKTREYILNMTPEHRNEL
FT                   GINKSTLWYIRKNPARVRRSNYTIRLRLKSQNNKYGN"
     MLANYIVDKH KELQFNVPDV TIKRDDDNKT REYILNMTPE HRNELGINKS TLWYIRKNPA        60
     RVRRSNYTIR LRLKSQNNKY GN                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page