(data stored in ACNUC10043 zone)

EMBL: AP011532.PE519

AP011532.PE519       Location/Qualifiers
FT   CDS             510563..511057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF134
FT                   family (IPR002852)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60591"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVW9"
FT                   /protein_id="BAI60591.1"
FT                   /translation="MVRKVKRRVSCLPKATYYKPREIPMCDLEIVNLSIEELEAIRLCD
FT                   LLQVEQNEAADMMGISRKTFWNDLQKARQKVVDALVNGKAIEISGGEYVNSGECKVEFF
FT                   CRDCGNLWESPCGSGRPGACPSCSSKSIYRKGGDGRGRRLLDNGYRCPKDTKEGTKNGS
FT                   E"
     MVRKVKRRVS CLPKATYYKP REIPMCDLEI VNLSIEELEA IRLCDLLQVE QNEAADMMGI        60
     SRKTFWNDLQ KARQKVVDAL VNGKAIEISG GEYVNSGECK VEFFCRDCGN LWESPCGSGR       120
     PGACPSCSSK SIYRKGGDGR GRRLLDNGYR CPKDTKEGTK NGSE                        164
//

If you have problems or comments...

PBIL Back to PBIL home page