(data stored in ACNUC10043 zone)

EMBL: AP011532.PE536

AP011532.PE536       Location/Qualifiers
FT   CDS             complement(522821..523912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0536"
FT                   /product="putative histidine kinase"
FT                   /note="Contains one ATP-binding region, ATPase-like domain
FT                   (IPR003594)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60608"
FT                   /db_xref="GOA:D1YVY6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY6"
FT                   /protein_id="BAI60608.1"
FT                   /translation="MIAVYVNICNNTSIVYTHLFYVPIILASIWYRRLALLVAVCLGIL
FT                   HVVINLSLNSFTYEPIIRAVFFVIVGYFASSFAESNFALLNRSRASEAKIWGIRDELEE
FT                   LVEERTRELKNANESLRNEIHAKRQVEKALRDARDQAELYVDLISHDIGNMNQAIMGYL
FT                   EIALALINPRGEERDLIVRPLEIINNSSKLIGNVRKLQRAQAGEIPPEACDLGEVLSEV
FT                   KASYSRVPGRDVTIDYAPAGKRTVMANELLKDVFSNIVENSIKHSSGPLTISIGLATMQ
FT                   RDDAAYYVVSIEDNGPGISDAQKKKVFMSFSQNKEKPTRRGFGLHLVKTLVEIYKGSVW
FT                   VEDRVPGDHTKGCRFVVMLPSRG"
     MIAVYVNICN NTSIVYTHLF YVPIILASIW YRRLALLVAV CLGILHVVIN LSLNSFTYEP        60
     IIRAVFFVIV GYFASSFAES NFALLNRSRA SEAKIWGIRD ELEELVEERT RELKNANESL       120
     RNEIHAKRQV EKALRDARDQ AELYVDLISH DIGNMNQAIM GYLEIALALI NPRGEERDLI       180
     VRPLEIINNS SKLIGNVRKL QRAQAGEIPP EACDLGEVLS EVKASYSRVP GRDVTIDYAP       240
     AGKRTVMANE LLKDVFSNIV ENSIKHSSGP LTISIGLATM QRDDAAYYVV SIEDNGPGIS       300
     DAQKKKVFMS FSQNKEKPTR RGFGLHLVKT LVEIYKGSVW VEDRVPGDHT KGCRFVVMLP       360
     SRG                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page