(data stored in ACNUC10043 zone)

EMBL: AP011532.PE537

AP011532.PE537       Location/Qualifiers
FT   CDS             complement(524244..524495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60609"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY7"
FT                   /protein_id="BAI60609.1"
FT                   /translation="MGMLVTFEVMEKKGELVAVHDGSLGLLVALGNDWDMLRDTINETV
FT                   SDALGEVTADVEIELFIDANHRTRFKYVYDRAVADRTG"
     MGMLVTFEVM EKKGELVAVH DGSLGLLVAL GNDWDMLRDT INETVSDALG EVTADVEIEL        60
     FIDANHRTRF KYVYDRAVAD RTG                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page