(data stored in ACNUC10043 zone)

EMBL: AP011532.PE538

AP011532.PE538       Location/Qualifiers
FT   CDS             complement(524595..524933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF202
FT                   family (IPR003807)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60610"
FT                   /db_xref="GOA:D1YVY8"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY8"
FT                   /protein_id="BAI60610.1"
FT                   /translation="MSTTTLAMQRNIMANERTFSAWLRTGLALIVAAIALPRIIHFVYW
FT                   AWTLKLIGLIFIAIATTVFIVAYWRYEAESKKLMCAGAVMTPAWLIKVLTILLMATSVI
FT                   SVALLLHE"
     MSTTTLAMQR NIMANERTFS AWLRTGLALI VAAIALPRII HFVYWAWTLK LIGLIFIAIA        60
     TTVFIVAYWR YEAESKKLMC AGAVMTPAWL IKVLTILLMA TSVISVALLL HE               112
//

If you have problems or comments...

PBIL Back to PBIL home page