(data stored in ACNUC10043 zone)

EMBL: AP011532.PE550

AP011532.PE550       Location/Qualifiers
FT   CDS             534095..535618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Uncharacterised conserved protein
FT                   UCP016937 family (IPR008303)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60622"
FT                   /db_xref="InterPro:IPR008303"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW00"
FT                   /protein_id="BAI60622.1"
FT                   /translation="MISMQLKPLSRLLGPKPHIADSPYLSLVPKTGSPGMSAKIDLSTT
FT                   SYYVVASVEMGNTTTKCILTATNLETGKTYLLNKTVKMSRDVRPPKEGEKVFGKTLDGK
FT                   KLTRESVGELVRQTLEEAHKAAGLTISQDLNFVVRSTGVVAGFDKPEDVGSFILALADG
FT                   CITAGVPPKNMTPAMNKDNLNPPRLRKFSQLDKVYFDGAVASVLPPMGSSGVEIVANEM
FT                   EGELATAGIKEAAKWAGVDFRNPVCSIDFGTTLKGRMTNDLAPYSRTIGNFCGLAGAVP
FT                   DAIVRGSGLVDSEFGNVLDITTKERPGLLAEIMNSKGIEEHAKWAHEMVQIDVVPDERR
FT                   WWGSVPVNPKAARNNGVTLIGCEVGENGKDLPKLNEVGASLIKKYNVNTMLATLDLVSA
FT                   MIAERLLKKALENNLISSKTTIGITGRAGITGDKPALILQKVTEMGIFDSPNDHLVFCD
FT                   DGLARGAAVMARCMNSYGTPKNPLGGLRGGKCILGARMKLQNKDKKTEA"
     MISMQLKPLS RLLGPKPHIA DSPYLSLVPK TGSPGMSAKI DLSTTSYYVV ASVEMGNTTT        60
     KCILTATNLE TGKTYLLNKT VKMSRDVRPP KEGEKVFGKT LDGKKLTRES VGELVRQTLE       120
     EAHKAAGLTI SQDLNFVVRS TGVVAGFDKP EDVGSFILAL ADGCITAGVP PKNMTPAMNK       180
     DNLNPPRLRK FSQLDKVYFD GAVASVLPPM GSSGVEIVAN EMEGELATAG IKEAAKWAGV       240
     DFRNPVCSID FGTTLKGRMT NDLAPYSRTI GNFCGLAGAV PDAIVRGSGL VDSEFGNVLD       300
     ITTKERPGLL AEIMNSKGIE EHAKWAHEMV QIDVVPDERR WWGSVPVNPK AARNNGVTLI       360
     GCEVGENGKD LPKLNEVGAS LIKKYNVNTM LATLDLVSAM IAERLLKKAL ENNLISSKTT       420
     IGITGRAGIT GDKPALILQK VTEMGIFDSP NDHLVFCDDG LARGAAVMAR CMNSYGTPKN       480
     PLGGLRGGKC ILGARMKLQN KDKKTEA                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page