(data stored in ACNUC10043 zone)

EMBL: AP011532.PE555

AP011532.PE555       Location/Qualifiers
FT   CDS             538244..538897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one TfuA-like, core domain (IPR012924)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60627"
FT                   /db_xref="InterPro:IPR012924"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW05"
FT                   /protein_id="BAI60627.1"
FT                   /translation="MSKVIVYLGPSLSIEKAKAILEADYRPPIRRGDLKKALKSGVDIV
FT                   GIIDGTFFNDSPVAHKEILDVLKKGVTVVGGSSMGALRASELDVFGMVGVGRIYECYRS
FT                   GRIEADDEVAVTYNPVTGEQISEPLVNVRYQLKAAEKDDVMTKKEKDALLSMAAGMHYP
FT                   DRTYPNILKMSVEKGLLSSDKADSLLKYINEKPLNLKAEDAVAVLEKIKKISIS"
     MSKVIVYLGP SLSIEKAKAI LEADYRPPIR RGDLKKALKS GVDIVGIIDG TFFNDSPVAH        60
     KEILDVLKKG VTVVGGSSMG ALRASELDVF GMVGVGRIYE CYRSGRIEAD DEVAVTYNPV       120
     TGEQISEPLV NVRYQLKAAE KDDVMTKKEK DALLSMAAGM HYPDRTYPNI LKMSVEKGLL       180
     SSDKADSLLK YINEKPLNLK AEDAVAVLEK IKKISIS                                217
//

If you have problems or comments...

PBIL Back to PBIL home page