(data stored in ACNUC10043 zone)

EMBL: AP011532.PE557

AP011532.PE557       Location/Qualifiers
FT   CDS             complement(539742..540086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60629"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW07"
FT                   /protein_id="BAI60629.1"
FT                   /translation="MSRELSEYDWDILKKLCPELNDGTCVSSGRMYRSILPPLSRHYAK
FT                   SREDFMERVEKLSDEELDYLICLAENGEESLTCIVPEHKDAFLEMVGRRTTKERAAKLR
FT                   KFIDFLETLG"
     MSRELSEYDW DILKKLCPEL NDGTCVSSGR MYRSILPPLS RHYAKSREDF MERVEKLSDE        60
     ELDYLICLAE NGEESLTCIV PEHKDAFLEM VGRRTTKERA AKLRKFIDFL ETLG             114
//

If you have problems or comments...

PBIL Back to PBIL home page