(data stored in ACNUC10043 zone)

EMBL: AP011532.PE558

AP011532.PE558       Location/Qualifiers
FT   CDS             540180..541370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one 40-residue YVTN beta-propeller repeat
FT                   (IPR011964)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60630"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW08"
FT                   /protein_id="BAI60630.1"
FT                   /translation="MMRRVPIIVIAVTLAFLACGMAQAAVPAPGQGFLYVANTDQRTVT
FT                   VIDMQTDAVLRTIEVGGQINGIAADPTGYYVYLACYDGVRIIDTQTDDSRNVGMGQGPK
FT                   AITVSPDGSGYYVLYGNYINLAKIGSGDVAQKITLPRNKDIMAVSPDGSMACLGSAYFE
FT                   TIGLYKVPSGESASPEIDFGQSVYCTFSPDNEYAYISLKDQKKVIALKAHDYFIKYDIS
FT                   VPSNPGGLAVSPDGSTLYATLPSENKVVAVNTSSRSVLGTIDVGDSPQQIIFSPDGNKA
FT                   YVSDANSNAISVIDTSGLPGNIGNVTKTISVGSRPVYLAIASKPALPTDTPTPTPVPTP
FT                   TPVPTPTPTAVPTEMPTPTSQPATPTPTPTPQPSPGFEVLAALACLATAGIYRIKK"
     MMRRVPIIVI AVTLAFLACG MAQAAVPAPG QGFLYVANTD QRTVTVIDMQ TDAVLRTIEV        60
     GGQINGIAAD PTGYYVYLAC YDGVRIIDTQ TDDSRNVGMG QGPKAITVSP DGSGYYVLYG       120
     NYINLAKIGS GDVAQKITLP RNKDIMAVSP DGSMACLGSA YFETIGLYKV PSGESASPEI       180
     DFGQSVYCTF SPDNEYAYIS LKDQKKVIAL KAHDYFIKYD ISVPSNPGGL AVSPDGSTLY       240
     ATLPSENKVV AVNTSSRSVL GTIDVGDSPQ QIIFSPDGNK AYVSDANSNA ISVIDTSGLP       300
     GNIGNVTKTI SVGSRPVYLA IASKPALPTD TPTPTPVPTP TPVPTPTPTA VPTEMPTPTS       360
     QPATPTPTPT PQPSPGFEVL AALACLATAG IYRIKK                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page