(data stored in ACNUC10043 zone)

EMBL: AP011532.PE562

AP011532.PE562       Location/Qualifiers
FT   CDS             complement(543538..544473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0562"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60634"
FT                   /db_xref="GOA:D1YW12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW12"
FT                   /protein_id="BAI60634.1"
FT                   /translation="MDDVVIGVSGLVKNYPNNPAVCNVSFKVRRGEIFALLGPNGAGKT
FT                   TIIKILEFVERPTSGFAYVLDSEQLYALTKDYTGIKEKIGALPQGFKGFDLLTVYENID
FT                   YFAQMYRKYGNVDRIIDEMGLRDKRNALFKHLSGGQKQRVGIAIALINDPEVVFLDEPT
FT                   TGLDPKARRDVWDMIKGLKARGKTVLLTTHYMDEAHQLADRICVLNRGSIVTHGTPEDL
FT                   INKYGGGNTLVVRGCSTGAIERLREALPGSLVSGNDVTVRLAYGDGMAAMAKAISVLGG
FT                   DGHLCQELYVKKPTLEDVFLNLTGERLDDA"
     MDDVVIGVSG LVKNYPNNPA VCNVSFKVRR GEIFALLGPN GAGKTTIIKI LEFVERPTSG        60
     FAYVLDSEQL YALTKDYTGI KEKIGALPQG FKGFDLLTVY ENIDYFAQMY RKYGNVDRII       120
     DEMGLRDKRN ALFKHLSGGQ KQRVGIAIAL INDPEVVFLD EPTTGLDPKA RRDVWDMIKG       180
     LKARGKTVLL TTHYMDEAHQ LADRICVLNR GSIVTHGTPE DLINKYGGGN TLVVRGCSTG       240
     AIERLREALP GSLVSGNDVT VRLAYGDGMA AMAKAISVLG GDGHLCQELY VKKPTLEDVF       300
     LNLTGERLDD A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page