(data stored in ACNUC10043 zone)

EMBL: AP011532.PE563

AP011532.PE563       Location/Qualifiers
FT   CDS             complement(544499..544978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60635"
FT                   /db_xref="InterPro:IPR019271"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW13"
FT                   /protein_id="BAI60635.1"
FT                   /translation="MRLKCRVGCPSYGTNLKCPPFVPTPDEFRQALKEYGFAMVLKHKP
FT                   PAMPETPGTAEERLAALRTQYREYYRTTLAIMLELEKVAFGRGYTFATAFVGGSCHLYE
FT                   KCNVEKGMCLSPAMARIAAEAVGVNVMKTAKNAGMAVKFPPEAKSPEPMALLLID"
     MRLKCRVGCP SYGTNLKCPP FVPTPDEFRQ ALKEYGFAMV LKHKPPAMPE TPGTAEERLA        60
     ALRTQYREYY RTTLAIMLEL EKVAFGRGYT FATAFVGGSC HLYEKCNVEK GMCLSPAMAR       120
     IAAEAVGVNV MKTAKNAGMA VKFPPEAKSP EPMALLLID                              159
//

If you have problems or comments...

PBIL Back to PBIL home page