(data stored in ACNUC10043 zone)

EMBL: AP011532.PE566

AP011532.PE566       Location/Qualifiers
FT   CDS             complement(546597..548315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0566"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60638"
FT                   /db_xref="GOA:D1YW16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW16"
FT                   /protein_id="BAI60638.1"
FT                   /translation="MPIAVMADTGAGIKFWDAVSQKYDNAVDGTMGKNLRPTALEKLSQ
FT                   EAGLGRAVELGCGTGYFTKTLARVADSVVATDFCEGMLARAMERLSSAGNITFQKEDCM
FT                   KTSFPDDTFDTVLMALVLNYIPDPAAALAEARRILKPGGRLIIVNPDNSFIGEARKRLS
FT                   SYKLMAGYGDAQVRYPQTFRNLSADGLYKMLETAGFKIEASELIRDDPGSYECAIDAME
FT                   YVRAAKATEDFDMLMSVVKSHGRRGRPGNAIDVRYLVKNYGKFPAVCGVSFYVRTGEVF
FT                   ALLGPNGAGKTTIVEVLELLKTPTRGFISIFGNAVLTGIRTELGGNPFPGEKRDYGNIK
FT                   ERIGVLPQGFNLFGLLTVYENIDYFARMYSKHVDVDRMIDELGLREKRNALFKDLSGGL
FT                   KQRVGIAIALINDPDIVFLDEPTTGLDPRSRRDVWEAIKAIKAKGKTVFLTTHYMDEAY
FT                   HLADRVCIINKGIVIVEGTPEDLINRHGGGNVLVIRECNAEALDPLSKAIPGSTIEGDS
FT                   VLVKLRGSDGMASIAKAVEVIKSGGFACREIYVKKPTLEDVFLNLTGENLVEGGT"
     MPIAVMADTG AGIKFWDAVS QKYDNAVDGT MGKNLRPTAL EKLSQEAGLG RAVELGCGTG        60
     YFTKTLARVA DSVVATDFCE GMLARAMERL SSAGNITFQK EDCMKTSFPD DTFDTVLMAL       120
     VLNYIPDPAA ALAEARRILK PGGRLIIVNP DNSFIGEARK RLSSYKLMAG YGDAQVRYPQ       180
     TFRNLSADGL YKMLETAGFK IEASELIRDD PGSYECAIDA MEYVRAAKAT EDFDMLMSVV       240
     KSHGRRGRPG NAIDVRYLVK NYGKFPAVCG VSFYVRTGEV FALLGPNGAG KTTIVEVLEL       300
     LKTPTRGFIS IFGNAVLTGI RTELGGNPFP GEKRDYGNIK ERIGVLPQGF NLFGLLTVYE       360
     NIDYFARMYS KHVDVDRMID ELGLREKRNA LFKDLSGGLK QRVGIAIALI NDPDIVFLDE       420
     PTTGLDPRSR RDVWEAIKAI KAKGKTVFLT THYMDEAYHL ADRVCIINKG IVIVEGTPED       480
     LINRHGGGNV LVIRECNAEA LDPLSKAIPG STIEGDSVLV KLRGSDGMAS IAKAVEVIKS       540
     GGFACREIYV KKPTLEDVFL NLTGENLVEG GT                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page