(data stored in ACNUC10043 zone)

EMBL: AP011532.PE572

AP011532.PE572       Location/Qualifiers
FT   CDS             553928..555373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0572"
FT                   /product="hypothetical protein"
FT                   /note="Contains at least one PT repeat (IPR006970)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60644"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW22"
FT                   /protein_id="BAI60644.1"
FT                   /translation="MVFSVIRKPLALLLVVVMVGAIMLMAVNGAIGQQGPGPVDYGGGY
FT                   AVPGAPGISLGPGTNTVAMSVSIASQQDSQIYFQVNSFAVRDQQTQTFTVYDLSSAMPG
FT                   IMDTGNNRVQIDIGKLQSSIQSTSQAAMDDLYSILRPSVNSLMVVADISQQGQQGSRAT
FT                   FQVERLTVIMPDGQTSEFDLSQPMSIVVDGAALRIFAVGFEQMYSLVNTYIVNIQNNYY
FT                   TEINYNIVTGPVIVVTPPAVYPVLTPIRFPAAWPVFYPVPVPVPIPVVSVRPHPPSVTP
FT                   TKQPTMGPTVSPTKGPTISPTARPTGMPTVSPRISPTIGPTKRPITSPRASLIATRRPV
FT                   ISPGATISPSLIPTRRPVGTFSPSLIATKKAAPSLIATKKATPTFQATKAPGGIATKRP
FT                   ISATYRPTTGPVTRPTIKATQAPVGGGAKRPIATMPVTPRKPTAGDERIRRSLQPPLST
FT                   IVPGTAASPSPSPTATIRPTKVI"
     MVFSVIRKPL ALLLVVVMVG AIMLMAVNGA IGQQGPGPVD YGGGYAVPGA PGISLGPGTN        60
     TVAMSVSIAS QQDSQIYFQV NSFAVRDQQT QTFTVYDLSS AMPGIMDTGN NRVQIDIGKL       120
     QSSIQSTSQA AMDDLYSILR PSVNSLMVVA DISQQGQQGS RATFQVERLT VIMPDGQTSE       180
     FDLSQPMSIV VDGAALRIFA VGFEQMYSLV NTYIVNIQNN YYTEINYNIV TGPVIVVTPP       240
     AVYPVLTPIR FPAAWPVFYP VPVPVPIPVV SVRPHPPSVT PTKQPTMGPT VSPTKGPTIS       300
     PTARPTGMPT VSPRISPTIG PTKRPITSPR ASLIATRRPV ISPGATISPS LIPTRRPVGT       360
     FSPSLIATKK AAPSLIATKK ATPTFQATKA PGGIATKRPI SATYRPTTGP VTRPTIKATQ       420
     APVGGGAKRP IATMPVTPRK PTAGDERIRR SLQPPLSTIV PGTAASPSPS PTATIRPTKV       480
     I                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page