(data stored in ACNUC10043 zone)

EMBL: AP011532.PE577

AP011532.PE577       Location/Qualifiers
FT   CDS             complement(559579..559788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60649"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW27"
FT                   /protein_id="BAI60649.1"
FT                   /translation="MDIQPVYLETDIDEVYVRHVCDKGDEFFVKMIKPKNTKYMLYVSG
FT                   NSLACPICNNMAKKTTEAPLPQSR"
     MDIQPVYLET DIDEVYVRHV CDKGDEFFVK MIKPKNTKYM LYVSGNSLAC PICNNMAKKT        60
     TEAPLPQSR                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page