(data stored in ACNUC10043 zone)

EMBL: AP011532.PE590

AP011532.PE590       Location/Qualifiers
FT   CDS             574888..576156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Conserved hypothetical protein 300
FT                   family (IPR005239).; Contains one LOR/SDH bifunctional
FT                   enzyme conserved region domain (IPR007545)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60662"
FT                   /db_xref="InterPro:IPR005239"
FT                   /db_xref="InterPro:IPR007545"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW40"
FT                   /protein_id="BAI60662.1"
FT                   /translation="MEAMREIELRGHIIDSFLLPKVFDKVMDMNGEFEIIEFEIGKHKT
FT                   DTSYARLMIRGKDQEHLDDIIGELHRLGAYVPEAEDAVVAEAPKDKVVPKGFYSTTNHP
FT                   TFVKVDGEWLRVKNQKMDSLIVLRNGSAACKTIGHVKKGDRVVIGNSGIRVVPPERPRG
FT                   HTIFDFMGSQVSSERPSQSLIREIAEEIFEVHESGGKIVVVGGPAIVHTGGQQALAELV
FT                   RKGYVDALLSGNALAVHDVEYNLYGTSLGMDLKTAELAPEGHKHHLYAISEITRAGSLK
FT                   EAVKQGVLTGGIMYECIVNNVPYVLAGSIRDDGPLPDVITDTMKAQDLMREQVKNADIV
FT                   LMMATMLHSIATGNCLSSSVRTICVDINPSTVTKLMDRGTAQAIGIVTDVGTFLPWLAE
FT                   ELDNLEKSRKKQMPALRVKSKKR"
     MEAMREIELR GHIIDSFLLP KVFDKVMDMN GEFEIIEFEI GKHKTDTSYA RLMIRGKDQE        60
     HLDDIIGELH RLGAYVPEAE DAVVAEAPKD KVVPKGFYST TNHPTFVKVD GEWLRVKNQK       120
     MDSLIVLRNG SAACKTIGHV KKGDRVVIGN SGIRVVPPER PRGHTIFDFM GSQVSSERPS       180
     QSLIREIAEE IFEVHESGGK IVVVGGPAIV HTGGQQALAE LVRKGYVDAL LSGNALAVHD       240
     VEYNLYGTSL GMDLKTAELA PEGHKHHLYA ISEITRAGSL KEAVKQGVLT GGIMYECIVN       300
     NVPYVLAGSI RDDGPLPDVI TDTMKAQDLM REQVKNADIV LMMATMLHSI ATGNCLSSSV       360
     RTICVDINPS TVTKLMDRGT AQAIGIVTDV GTFLPWLAEE LDNLEKSRKK QMPALRVKSK       420
     KR                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page