(data stored in ACNUC10043 zone)

EMBL: AP011532.PE594

AP011532.PE594       Location/Qualifiers
FT   CDS             complement(577967..578545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Flavodoxin/nitric oxide synthase domain
FT                   (IPR008254)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60666"
FT                   /db_xref="GOA:D1YW44"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW44"
FT                   /protein_id="BAI60666.1"
FT                   /translation="MNALMIIGLVVVGIILLVAAIGIAMGALFCGDIMSYTDTGSKVLS
FT                   PAGASSGKALVVYNPGLSGASKNAANEIAGDLQSKGYTVTLAGIKSTAAANTTGYDVVI
FT                   AGGPMYWGRVSNSVDAYLKALKPQKGMAVGVFGTTGAPQFNDGDIATFGEQVTIDLGGV
FT                   VLDKKAATKTIRSGDAANRDCSDFVSAVV"
     MNALMIIGLV VVGIILLVAA IGIAMGALFC GDIMSYTDTG SKVLSPAGAS SGKALVVYNP        60
     GLSGASKNAA NEIAGDLQSK GYTVTLAGIK STAAANTTGY DVVIAGGPMY WGRVSNSVDA       120
     YLKALKPQKG MAVGVFGTTG APQFNDGDIA TFGEQVTIDL GGVVLDKKAA TKTIRSGDAA       180
     NRDCSDFVSA VV                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page