(data stored in ACNUC10043 zone)

EMBL: AP011532.PE599

AP011532.PE599       Location/Qualifiers
FT   CDS             581550..582236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60671"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW49"
FT                   /protein_id="BAI60671.1"
FT                   /translation="MQRHKITIALALLLASLMLVSVVAVASQDAGLKELRWGGRKAGGG
FT                   IDIVYHTIQVTGTTGDSMTFNILNTAVKGKSGNVTTKTYTPPVTATYYFSNDTAVLKGK
FT                   PAGMMERARERGRQGPPTKGYNDATINVAGASAVIALKNMTINRVDRNTTEVQFGAFSV
FT                   YLPDGTVKSYKLDTPVKDVRSRMEMTRKITGNPQFRADLQDALKGGATFPAGTAPVPLK
FT                   TIDSKM"
     MQRHKITIAL ALLLASLMLV SVVAVASQDA GLKELRWGGR KAGGGIDIVY HTIQVTGTTG        60
     DSMTFNILNT AVKGKSGNVT TKTYTPPVTA TYYFSNDTAV LKGKPAGMME RARERGRQGP       120
     PTKGYNDATI NVAGASAVIA LKNMTINRVD RNTTEVQFGA FSVYLPDGTV KSYKLDTPVK       180
     DVRSRMEMTR KITGNPQFRA DLQDALKGGA TFPAGTAPVP LKTIDSKM                    228
//

If you have problems or comments...

PBIL Back to PBIL home page