(data stored in ACNUC10043 zone)

EMBL: AP011532.PE608

AP011532.PE608       Location/Qualifiers
FT   CDS             587955..588647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0608"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60680"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW58"
FT                   /protein_id="BAI60680.1"
FT                   /translation="MEKRGMRLNHLLTALLIVAVVAALSGCICCFGQDGFFSKLKKPVS
FT                   AIQFPSALKIGQKTYNKAYSNEYLDRDSAKSGLKAFARKLGYGSGDMQGLVDKAIELSG
FT                   INQYKSFKYTDGSAKGIVGGLVAKTDAPSTVTGGYEAIKQSATAGQSAINDPSQNTGDV
FT                   RNVVSGGSSSLGDGGDRYTMTVNGETCYVVVVKYSNMYISAYSFESYDACDAAIAMAIE
FT                   QVDIAASS"
     MEKRGMRLNH LLTALLIVAV VAALSGCICC FGQDGFFSKL KKPVSAIQFP SALKIGQKTY        60
     NKAYSNEYLD RDSAKSGLKA FARKLGYGSG DMQGLVDKAI ELSGINQYKS FKYTDGSAKG       120
     IVGGLVAKTD APSTVTGGYE AIKQSATAGQ SAINDPSQNT GDVRNVVSGG SSSLGDGGDR       180
     YTMTVNGETC YVVVVKYSNM YISAYSFESY DACDAAIAMA IEQVDIAASS                  230
//

If you have problems or comments...

PBIL Back to PBIL home page