(data stored in ACNUC10043 zone)

EMBL: AP011532.PE61

AP011532.PE61        Location/Qualifiers
FT   CDS             complement(53768..54058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60133"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL1"
FT                   /protein_id="BAI60133.1"
FT                   /translation="MYSIDSRVHMTYVDDDDIDDMEAGDTDEISRDEAGRCDECGLKVK
FT                   KEDALQCHMCSAVYHRWCAGAECNVCKTPMEVKAVTKAAPRSEKPRKRTKR"
     MYSIDSRVHM TYVDDDDIDD MEAGDTDEIS RDEAGRCDEC GLKVKKEDAL QCHMCSAVYH        60
     RWCAGAECNV CKTPMEVKAV TKAAPRSEKP RKRTKR                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page