(data stored in ACNUC10043 zone)

EMBL: AP011532.PE615

AP011532.PE615       Location/Qualifiers
FT   CDS             594816..596195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60687"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW65"
FT                   /protein_id="BAI60687.1"
FT                   /translation="MDASRSLNIARRRFQNGNYMLSLKKFPAARKEFEVALSIFEKGDA
FT                   YRETAEALNNIGITYVKEGEPEEAKGYFERSYELKKVHDEACDSPGSKSPVRESLFNSL
FT                   YNIVGLGDALTPEEFEKYFLEMKALGDSLGGEHAGIVAKEQQAYDRFVEAKEAERKRQE
FT                   EEALARTTPAGALAHLERLGKPCVIGLRFALQGITVTVPEFSYDDGVRVRLSGITPGDG
FT                   MSAGEIEFRVDYDSVREFLEKTEEPALLEEAFEHVKKFMEAVALVREDIDFCVGKRGYS
FT                   VLSITLKNAFGDPVEIYHADAAAPVAAAALTGEDAMLVGMMLSAKHGLYKMLLLNAKRS
FT                   MAEENHSLCIVDAVASFEAFMDLLLKKALPEAEKKDYLSMENPCLRERLRFMKRLIGGT
FT                   DASDSLEHYMGDVGRDMDDVLAYYDSIMGNDEHTIGAYESRKALVAVSRAIYNLKALYD
FT                   I"
     MDASRSLNIA RRRFQNGNYM LSLKKFPAAR KEFEVALSIF EKGDAYRETA EALNNIGITY        60
     VKEGEPEEAK GYFERSYELK KVHDEACDSP GSKSPVRESL FNSLYNIVGL GDALTPEEFE       120
     KYFLEMKALG DSLGGEHAGI VAKEQQAYDR FVEAKEAERK RQEEEALART TPAGALAHLE       180
     RLGKPCVIGL RFALQGITVT VPEFSYDDGV RVRLSGITPG DGMSAGEIEF RVDYDSVREF       240
     LEKTEEPALL EEAFEHVKKF MEAVALVRED IDFCVGKRGY SVLSITLKNA FGDPVEIYHA       300
     DAAAPVAAAA LTGEDAMLVG MMLSAKHGLY KMLLLNAKRS MAEENHSLCI VDAVASFEAF       360
     MDLLLKKALP EAEKKDYLSM ENPCLRERLR FMKRLIGGTD ASDSLEHYMG DVGRDMDDVL       420
     AYYDSIMGND EHTIGAYESR KALVAVSRAI YNLKALYDI                              459
//

If you have problems or comments...

PBIL Back to PBIL home page