(data stored in ACNUC10043 zone)

EMBL: AP011532.PE628

AP011532.PE628       Location/Qualifiers
FT   CDS             complement(609329..612850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0628"
FT                   /product="chromosome segregation protein SMC"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60700"
FT                   /db_xref="GOA:D1YW78"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW78"
FT                   /protein_id="BAI60700.1"
FT                   /translation="MHIKEIELNNFKSFGRKAKIPFFDDFTTISGPNGSGKSNVIDSIL
FT                   FCLGLSNSRSMRAEKLTDLIYSVNGKSPGSADVTIRFDNTDREMPIDQDEVTITRRIKS
FT                   SDSGYYSYYYFNEKPVSLSEIHEHLLKAKISPDGYNVVMQGDVTRIIEVSNFERRKMID
FT                   EIAGTAEFDEKTDKALSELDIVRDRIDRVAIIISEVEARLAQLKDERDHALLYQSYRDE
FT                   KVKNEGYLVLSELKEAQQLLDSLLEDIRDKTDKRAAITADVEKKSAAVQKLKDDIKALN
FT                   ATITEKGEGEQILIRRQIEEARAGIKACISIIDFSKSEIANRDSEKQKLFLETEKAKGQ
FT                   IEEYDGKIAEEEKRKLSLTNELNFRQASLDEVQKKISAIDEKFIGVRTRLVEVKAALEA
FT                   SRNLRNEKLREKDRILDAARRKQDEEQDASTEITSSRSRIEEARVESKNLEKDVAELQR
FT                   RSQALTADINDMEGARSRTRAEQHGIEEKLRKLQEEFAKAEARVRAYEDLDGYSEAVGT
FT                   IIGARNSHELPGIYGTIAELGKVDQEYATALEVAAGNRMQNIVVDNDEDAARCIYYLKG
FT                   QRKGTATFLPLNKMRQRVQLRNIREPGVIDYAINLVQFDGRFDPAFWYVFGDTLVVDTL
FT                   ETARRLIGTGRMVTLDGDLVEKSGAMTGGYRSRTKLKFKASEEEHIKELAEQITILESS
FT                   RDSVLKKVESIDGHIYGLKKDRSDMETQASKLTARKEELAGRLTRLEAVIKEKEASIES
FT                   LREDRRKLRDELIAAEEAISKADSEITTIGAEAGKLEEELKGSEVPALTEESGRIEDEM
FT                   KRLDGRLRDTESAIASLKIEQNYVRARVEENKGRGEKVDENIASLREKISQNEAAIGEF
FT                   NGKIEDLTKREKAIESELAGMKKQRDEMSDALTAADHDLYDARRSLERLTGMLNSLEIA
FT                   REESLDKIKVFEKVVQERGVMPSEDVPPVDKVRASISQLEKKMQALEPVNMLSITEYDG
FT                   VQARLAELTGKRDTLQKERENILEKIEHYKTMKMETFLTTFNAINEQFKVIFNELSDGF
FT                   GELVLESPEDPFSGGLTIRAQPYGKSLYRLEAMSGGEKSLTALAFIFAIQRYKPAPFYA
FT                   FDEIDMFLDGANAERVARMIKKLSTNAQFIVVSLRKPMIESANRTIGIAMQENNISSIT
FT                   GVKLRAD"
     MHIKEIELNN FKSFGRKAKI PFFDDFTTIS GPNGSGKSNV IDSILFCLGL SNSRSMRAEK        60
     LTDLIYSVNG KSPGSADVTI RFDNTDREMP IDQDEVTITR RIKSSDSGYY SYYYFNEKPV       120
     SLSEIHEHLL KAKISPDGYN VVMQGDVTRI IEVSNFERRK MIDEIAGTAE FDEKTDKALS       180
     ELDIVRDRID RVAIIISEVE ARLAQLKDER DHALLYQSYR DEKVKNEGYL VLSELKEAQQ       240
     LLDSLLEDIR DKTDKRAAIT ADVEKKSAAV QKLKDDIKAL NATITEKGEG EQILIRRQIE       300
     EARAGIKACI SIIDFSKSEI ANRDSEKQKL FLETEKAKGQ IEEYDGKIAE EEKRKLSLTN       360
     ELNFRQASLD EVQKKISAID EKFIGVRTRL VEVKAALEAS RNLRNEKLRE KDRILDAARR       420
     KQDEEQDAST EITSSRSRIE EARVESKNLE KDVAELQRRS QALTADINDM EGARSRTRAE       480
     QHGIEEKLRK LQEEFAKAEA RVRAYEDLDG YSEAVGTIIG ARNSHELPGI YGTIAELGKV       540
     DQEYATALEV AAGNRMQNIV VDNDEDAARC IYYLKGQRKG TATFLPLNKM RQRVQLRNIR       600
     EPGVIDYAIN LVQFDGRFDP AFWYVFGDTL VVDTLETARR LIGTGRMVTL DGDLVEKSGA       660
     MTGGYRSRTK LKFKASEEEH IKELAEQITI LESSRDSVLK KVESIDGHIY GLKKDRSDME       720
     TQASKLTARK EELAGRLTRL EAVIKEKEAS IESLREDRRK LRDELIAAEE AISKADSEIT       780
     TIGAEAGKLE EELKGSEVPA LTEESGRIED EMKRLDGRLR DTESAIASLK IEQNYVRARV       840
     EENKGRGEKV DENIASLREK ISQNEAAIGE FNGKIEDLTK REKAIESELA GMKKQRDEMS       900
     DALTAADHDL YDARRSLERL TGMLNSLEIA REESLDKIKV FEKVVQERGV MPSEDVPPVD       960
     KVRASISQLE KKMQALEPVN MLSITEYDGV QARLAELTGK RDTLQKEREN ILEKIEHYKT      1020
     MKMETFLTTF NAINEQFKVI FNELSDGFGE LVLESPEDPF SGGLTIRAQP YGKSLYRLEA      1080
     MSGGEKSLTA LAFIFAIQRY KPAPFYAFDE IDMFLDGANA ERVARMIKKL STNAQFIVVS      1140
     LRKPMIESAN RTIGIAMQEN NISSITGVKL RAD                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page