(data stored in ACNUC10043 zone)

EMBL: AP011532.PE63

AP011532.PE63        Location/Qualifiers
FT   CDS             complement(54638..55066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60135"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL3"
FT                   /protein_id="BAI60135.1"
FT                   /translation="MSIVKSRLRLYLNTDVILSLLTNESGKGENVAKLLYQAADGKYQV
FT                   LVSEHTAYELLRLGVPMEYVNQVLRPLLLLNGSDVLVANSDIMRSAERTMRQYEMPFMR
FT                   ALHVVFAQRNNSLVLTRDIDFTNSARALVGIMTPEDLL"
     MSIVKSRLRL YLNTDVILSL LTNESGKGEN VAKLLYQAAD GKYQVLVSEH TAYELLRLGV        60
     PMEYVNQVLR PLLLLNGSDV LVANSDIMRS AERTMRQYEM PFMRALHVVF AQRNNSLVLT       120
     RDIDFTNSAR ALVGIMTPED LL                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page