(data stored in ACNUC10043 zone)

EMBL: AP011532.PE631

AP011532.PE631       Location/Qualifiers
FT   CDS             615649..616731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0631"
FT                   /product="putative translation initiation factor aIF-2B
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60703"
FT                   /db_xref="GOA:D1YW81"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW81"
FT                   /protein_id="BAI60703.1"
FT                   /translation="MWMRTIDWSDEKGCITIIDQTALPSKLVLLDIDHVNVLHEAILKL
FT                   RVRGAPALGAAGGFGVALLARSIRANDFKDYIKKLTEGAESLKKVRPTAVNLSWGVDRV
FT                   LAAALTGKDRAEVESTALREAKALADEDVAQCRAIGEHGAKLLESSDTVMTHCNAGRLA
FT                   CVDWGTALGVIRSAVEQGKDIKVISCETRPLNQGSRITCFELMDDRIPVTLITDSMAGH
FT                   FMRAGKIQKVIVGADRIVEDAVFNKIGTYSHSVLAKAHGIPFYVAAPLSTFDFTRREKD
FT                   VIIEERDPEELRRWNATQIAPAGVPVYNPAFDATPMQNVTAIITEQGILEPPISFARLK
FT                   KSSSQKPYIRDRTKGVQDGI"
     MWMRTIDWSD EKGCITIIDQ TALPSKLVLL DIDHVNVLHE AILKLRVRGA PALGAAGGFG        60
     VALLARSIRA NDFKDYIKKL TEGAESLKKV RPTAVNLSWG VDRVLAAALT GKDRAEVEST       120
     ALREAKALAD EDVAQCRAIG EHGAKLLESS DTVMTHCNAG RLACVDWGTA LGVIRSAVEQ       180
     GKDIKVISCE TRPLNQGSRI TCFELMDDRI PVTLITDSMA GHFMRAGKIQ KVIVGADRIV       240
     EDAVFNKIGT YSHSVLAKAH GIPFYVAAPL STFDFTRREK DVIIEERDPE ELRRWNATQI       300
     APAGVPVYNP AFDATPMQNV TAIITEQGIL EPPISFARLK KSSSQKPYIR DRTKGVQDGI       360
//

If you have problems or comments...

PBIL Back to PBIL home page