(data stored in ACNUC10043 zone)

EMBL: AP011532.PE65

AP011532.PE65        Location/Qualifiers
FT   CDS             57847..58407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60137"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL5"
FT                   /protein_id="BAI60137.1"
FT                   /translation="MLRAVTNRDFPMLRESLKSLFGMELDVDPSLKPKGKNPIKRFFYG
FT                   QLSSDPRGRVRIIFVDTADVSYGWRKDVDVTGVNIPYKKLTFIGVPESVEPVDEECYGK
FT                   SSLDAYLLAVTLHELYELFTGDFGHCDNPGRCINSECGVYVVGTCSACMGALVDEKFPG
FT                   LKLEDLYCPEHLRKLKLALKKLD"
     MLRAVTNRDF PMLRESLKSL FGMELDVDPS LKPKGKNPIK RFFYGQLSSD PRGRVRIIFV        60
     DTADVSYGWR KDVDVTGVNI PYKKLTFIGV PESVEPVDEE CYGKSSLDAY LLAVTLHELY       120
     ELFTGDFGHC DNPGRCINSE CGVYVVGTCS ACMGALVDEK FPGLKLEDLY CPEHLRKLKL       180
     ALKKLD                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page