(data stored in ACNUC10043 zone)

EMBL: AP011532.PE661

AP011532.PE661       Location/Qualifiers
FT   CDS             complement(645614..645922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0661"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60733"
FT                   /db_xref="InterPro:IPR020501"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB1"
FT                   /protein_id="BAI60733.1"
FT                   /translation="MDFVVNEITKRLHDYLATDVQGIRRIVLQAFVKMKSLTADTLHRI
FT                   LMERGFSITLKQVTAMLGVIHSKLGILHAHKNSYDAKYEYSLKEKYEGIVQTALLSI"
     MDFVVNEITK RLHDYLATDV QGIRRIVLQA FVKMKSLTAD TLHRILMERG FSITLKQVTA        60
     MLGVIHSKLG ILHAHKNSYD AKYEYSLKEK YEGIVQTALL SI                          102
//

If you have problems or comments...

PBIL Back to PBIL home page