(data stored in ACNUC10043 zone)

EMBL: AP011532.PE670

AP011532.PE670       Location/Qualifiers
FT   CDS             complement(654604..655215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0670"
FT                   /product="putative amino acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60742"
FT                   /db_xref="GOA:D1YWC0"
FT                   /db_xref="InterPro:IPR011375"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC0"
FT                   /protein_id="BAI60742.1"
FT                   /translation="MVMLFVLKLGGSLFGHAPDILRRVADSGSDVLVVPGGGPFADLIR
FT                   EIDLERGLSANAAHWMAVLAMDQYAYYLHDKTGIELTPLLVRKKGVRIILPYEVLRRQD
FT                   ELPHSWDVTSDTIAAWMAYKTASDFIKATDVDGVMLEGQLQETVDASTLKGRETCVDRA
FT                   MPGFLVEHGMDALIINGTVEGRLEDALKGKTVKGTKIRGK"
     MVMLFVLKLG GSLFGHAPDI LRRVADSGSD VLVVPGGGPF ADLIREIDLE RGLSANAAHW        60
     MAVLAMDQYA YYLHDKTGIE LTPLLVRKKG VRIILPYEVL RRQDELPHSW DVTSDTIAAW       120
     MAYKTASDFI KATDVDGVML EGQLQETVDA STLKGRETCV DRAMPGFLVE HGMDALIING       180
     TVEGRLEDAL KGKTVKGTKI RGK                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page