(data stored in ACNUC10043 zone)

EMBL: AP011532.PE675

AP011532.PE675       Location/Qualifiers
FT   CDS             complement(658769..658945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0675"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60747"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC5"
FT                   /protein_id="BAI60747.1"
FT                   /translation="MITMAKEGCSCGINMSDLAMGTPYKDLGFRKVVCAKCGKEFFTDI
FT                   KGKTMCFECEKCP"
     MITMAKEGCS CGINMSDLAM GTPYKDLGFR KVVCAKCGKE FFTDIKGKTM CFECEKCP          58
//

If you have problems or comments...

PBIL Back to PBIL home page