(data stored in ACNUC10043 zone)

EMBL: AP011532.PE683

AP011532.PE683       Location/Qualifiers
FT   CDS             664002..665066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0683"
FT                   /product="putative arsenite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60755"
FT                   /db_xref="GOA:D1YWD3"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD3"
FT                   /protein_id="BAI60755.1"
FT                   /translation="MAETAKARLSFLDKYLTLWIFLAMALGVGLGYFYPALANFINSLS
FT                   IGTTSIPIALGLIVMMYPPLARVRYEEIGKVFRNVKVMALSLLQNWIIGPILMFILAIL
FT                   LLRNYPEYAAGLILIGIARCIAMVIVWNRLACGDSEYAAALVALNSIFQVIFYSIYAYI
FT                   FITVLPSWLGMQSMVVNITIWQVAESVLIYLGLPFAAAVLTRFVLRPRLGSDWYDNKFI
FT                   PAISPVTLLALLFTIVVMFSLKGQYIVSQPFDVVIIAIPLIIYFVIMFVVSFFISRYME
FT                   VNYEQSCTLSFTAASNNFELAIAVAVGVFGIDSGQAFAAVIGPLIEVPVMIALVNIALR
FT                   WREKYFTPKTWKGS"
     MAETAKARLS FLDKYLTLWI FLAMALGVGL GYFYPALANF INSLSIGTTS IPIALGLIVM        60
     MYPPLARVRY EEIGKVFRNV KVMALSLLQN WIIGPILMFI LAILLLRNYP EYAAGLILIG       120
     IARCIAMVIV WNRLACGDSE YAAALVALNS IFQVIFYSIY AYIFITVLPS WLGMQSMVVN       180
     ITIWQVAESV LIYLGLPFAA AVLTRFVLRP RLGSDWYDNK FIPAISPVTL LALLFTIVVM       240
     FSLKGQYIVS QPFDVVIIAI PLIIYFVIMF VVSFFISRYM EVNYEQSCTL SFTAASNNFE       300
     LAIAVAVGVF GIDSGQAFAA VIGPLIEVPV MIALVNIALR WREKYFTPKT WKGS             354
//

If you have problems or comments...

PBIL Back to PBIL home page