(data stored in ACNUC10043 zone)

EMBL: AP011532.PE685

AP011532.PE685       Location/Qualifiers
FT   CDS             complement(665853..666773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0685"
FT                   /product="ABC transporter ATP binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60757"
FT                   /db_xref="GOA:D1YWD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD5"
FT                   /protein_id="BAI60757.1"
FT                   /translation="MNAIEANRLTKYYGSLAAVDQVSFTVDEGEIFGFLGPNGAGKTTT
FT                   MRMLTGVIRPDEGTGSIMGYDVVKENIRAKQARGVVPDTSNAYVDISAWQNLLLTGDLY
FT                   GVPRRLTEERAEKLLRRFGLYEKRDQVVKGYSKGMKQRLILCMALVSEPPILFLDEPTS
FT                   GLDVESSRLIKDIVREVNKGGVTVFLTTHNMEEANQLCDRIAIIRSGRIVAVDSPEKLK
FT                   ARSKELQSIEVSFDRPIDLAGVPLSGIAKTVKAGDKYRLYTGDPDTVIKQLVDYAESER
FT                   LRIVALSLLSPSLEDVFVELTKKEA"
     MNAIEANRLT KYYGSLAAVD QVSFTVDEGE IFGFLGPNGA GKTTTMRMLT GVIRPDEGTG        60
     SIMGYDVVKE NIRAKQARGV VPDTSNAYVD ISAWQNLLLT GDLYGVPRRL TEERAEKLLR       120
     RFGLYEKRDQ VVKGYSKGMK QRLILCMALV SEPPILFLDE PTSGLDVESS RLIKDIVREV       180
     NKGGVTVFLT THNMEEANQL CDRIAIIRSG RIVAVDSPEK LKARSKELQS IEVSFDRPID       240
     LAGVPLSGIA KTVKAGDKYR LYTGDPDTVI KQLVDYAESE RLRIVALSLL SPSLEDVFVE       300
     LTKKEA                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page