(data stored in ACNUC10043 zone)

EMBL: AP011532.PE69

AP011532.PE69        Location/Qualifiers
FT   CDS             complement(62133..62786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60141"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL9"
FT                   /protein_id="BAI60141.1"
FT                   /translation="MASIRAHKDSNTLIIMKNSSYARPITHRINLILGMNARCMEQVAI
FT                   DGDLELGKNAQVTGSVRARNVILGPGSVVYGDVTAYGDLKALDNASVIGHVAVQGGAFV
FT                   RPGVRFGSLDVGGLIEIQGRPPSKHIQGKMVVNDDMDYPELKKMGAEAIKKAEPGKGHV
FT                   VQPPKSPGKAEPEKAADKVKPAAKGKQTQAQKKGKKKAPEEEKPKKKGFFGLFK"
     MASIRAHKDS NTLIIMKNSS YARPITHRIN LILGMNARCM EQVAIDGDLE LGKNAQVTGS        60
     VRARNVILGP GSVVYGDVTA YGDLKALDNA SVIGHVAVQG GAFVRPGVRF GSLDVGGLIE       120
     IQGRPPSKHI QGKMVVNDDM DYPELKKMGA EAIKKAEPGK GHVVQPPKSP GKAEPEKAAD       180
     KVKPAAKGKQ TQAQKKGKKK APEEEKPKKK GFFGLFK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page