(data stored in ACNUC10043 zone)

EMBL: AP011532.PE692

AP011532.PE692       Location/Qualifiers
FT   CDS             complement(670334..671110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0692"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60764"
FT                   /db_xref="GOA:D1YWE2"
FT                   /db_xref="InterPro:IPR025098"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE2"
FT                   /protein_id="BAI60764.1"
FT                   /translation="MEGYEGLSDLLSNSIKYGLSNKRSILIWGAVYLVTMLLFFAGYIG
FT                   GIFLLIMDEKSMIAWVLILISFIPVLILSVFLAGYVRRCLSGLFAGNDTVPDISDLAGM
FT                   AVDGLKLSAIYIEAVVLMFIVFIPSIVFILLSYRYEEAIIGYCLLYPIELILMILVLGL
FT                   NVVQWAIFADTGSLMSGLNPVKAARLIAGDLRYVAVAGIAALILYLILSVVSTVLTLLV
FT                   ITLLALPFAIMPFYFALIYILARFYQHAKGKLPAAG"
     MEGYEGLSDL LSNSIKYGLS NKRSILIWGA VYLVTMLLFF AGYIGGIFLL IMDEKSMIAW        60
     VLILISFIPV LILSVFLAGY VRRCLSGLFA GNDTVPDISD LAGMAVDGLK LSAIYIEAVV       120
     LMFIVFIPSI VFILLSYRYE EAIIGYCLLY PIELILMILV LGLNVVQWAI FADTGSLMSG       180
     LNPVKAARLI AGDLRYVAVA GIAALILYLI LSVVSTVLTL LVITLLALPF AIMPFYFALI       240
     YILARFYQHA KGKLPAAG                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page