(data stored in ACNUC10043 zone)

EMBL: AP011532.PE693

AP011532.PE693       Location/Qualifiers
FT   CDS             complement(671184..672158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0693"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Aminoglycoside phosphotransferase
FT                   domain (IPR002575)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0693"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60765"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE3"
FT                   /protein_id="BAI60765.1"
FT                   /translation="MHGRSRLYRYLKSGRLSAKAGFDRYPDLRVKQLGGSHNVYLVSDH
FT                   RSHKKCIVKSFAGSGPKSVQHMEKEYKRLRQAGRLVDDRRWVHVARPLCKSNGEGFFAE
FT                   ELVSGKALGDYMRDAMANGRDSELYEKLTMLAGFLALLHKKTERPSHVKPSNIRDELKK
FT                   HARQASKGGAFAPHELKRIESLVDNVTSNDLISQTRRGLVHGDANPSNFLYDKKRLNVI
FT                   DMERSGYRDPVYDLGMLAGELCHYAMKYGGNEYKADPFIGHLYWTYAGNFKDQLGTFIR
FT                   LTGRNPIYMANSLLRIARHPFFSPEYKRRLARKAYECLKSLKK"
     MHGRSRLYRY LKSGRLSAKA GFDRYPDLRV KQLGGSHNVY LVSDHRSHKK CIVKSFAGSG        60
     PKSVQHMEKE YKRLRQAGRL VDDRRWVHVA RPLCKSNGEG FFAEELVSGK ALGDYMRDAM       120
     ANGRDSELYE KLTMLAGFLA LLHKKTERPS HVKPSNIRDE LKKHARQASK GGAFAPHELK       180
     RIESLVDNVT SNDLISQTRR GLVHGDANPS NFLYDKKRLN VIDMERSGYR DPVYDLGMLA       240
     GELCHYAMKY GGNEYKADPF IGHLYWTYAG NFKDQLGTFI RLTGRNPIYM ANSLLRIARH       300
     PFFSPEYKRR LARKAYECLK SLKK                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page