(data stored in ACNUC10043 zone)

EMBL: AP011532.PE702

AP011532.PE702       Location/Qualifiers
FT   CDS             677040..677609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0702"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60774"
FT                   /db_xref="GOA:D1YWF2"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF2"
FT                   /protein_id="BAI60774.1"
FT                   /translation="MECHWKRKNFQSRKKDIKQNRKLTDMLKNGALGILALALILWAAN
FT                   FSYGFLHEAGHALVIKTLGGQVFEIYVNPLGTDAYTLHSFVSGTPGVLSMEIAGLTVTT
FT                   LLAFFTLLSDYAPLPIFMAMRTAIYALNYAPGTDIFEVQRLIGNYSLLITAALVLLNLA
FT                   CAAIAIQATIKNVSIREPVLQRLLHL"
     MECHWKRKNF QSRKKDIKQN RKLTDMLKNG ALGILALALI LWAANFSYGF LHEAGHALVI        60
     KTLGGQVFEI YVNPLGTDAY TLHSFVSGTP GVLSMEIAGL TVTTLLAFFT LLSDYAPLPI       120
     FMAMRTAIYA LNYAPGTDIF EVQRLIGNYS LLITAALVLL NLACAAIAIQ ATIKNVSIRE       180
     PVLQRLLHL                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page