(data stored in ACNUC10043 zone)

EMBL: AP011532.PE707

AP011532.PE707       Location/Qualifiers
FT   CDS             complement(682383..682577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0707"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60779"
FT                   /db_xref="GOA:D1YWF7"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF7"
FT                   /protein_id="BAI60779.1"
FT                   /translation="MVLGRIIAAIIAVLAFIVAWRLLDVFLGFSFGILLWVIKALLFLV
FT                   LLYVVYRLFAGRRGQPYLR"
     MVLGRIIAAI IAVLAFIVAW RLLDVFLGFS FGILLWVIKA LLFLVLLYVV YRLFAGRRGQ        60
     PYLR                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page