(data stored in ACNUC10043 zone)

EMBL: AP011532.PE708

AP011532.PE708       Location/Qualifiers
FT   CDS             complement(682652..683389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0708"
FT                   /product="glutamate synthase large subunit domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0708"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60780"
FT                   /db_xref="GOA:D1YWF8"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR035710"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF8"
FT                   /protein_id="BAI60780.1"
FT                   /translation="MVHIDAKEMPYRALNEKIRALAAEGEYSVELDNVCGQKYIGGGLK
FT                   GKMKIDVRGIPGNDLGIFMDGAEVVVHGNGQDGIGNTMNSGKVVVHGNAGDVIGYAMRG
FT                   GKVFIKGDVGYRVGIHMKAYGDMVPTIVIGGTASDFLGEYMAGGVMVLLGLTQNSHPQP
FT                   TGDYVGTGMHGGVIYVRGDIDDYYLGREVIKSEPDAKDIAIISRLVGEYCVTFGCDFDE
FT                   IMRKPFIKLAPRSHRPYGNLYTS"
     MVHIDAKEMP YRALNEKIRA LAAEGEYSVE LDNVCGQKYI GGGLKGKMKI DVRGIPGNDL        60
     GIFMDGAEVV VHGNGQDGIG NTMNSGKVVV HGNAGDVIGY AMRGGKVFIK GDVGYRVGIH       120
     MKAYGDMVPT IVIGGTASDF LGEYMAGGVM VLLGLTQNSH PQPTGDYVGT GMHGGVIYVR       180
     GDIDDYYLGR EVIKSEPDAK DIAIISRLVG EYCVTFGCDF DEIMRKPFIK LAPRSHRPYG       240
     NLYTS                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page