(data stored in ACNUC10043 zone)

EMBL: AP011532.PE71

AP011532.PE71        Location/Qualifiers
FT   CDS             64006..64596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60143"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM1"
FT                   /protein_id="BAI60143.1"
FT                   /translation="MAPMDEDNILGAINIRGQGDGMTSKNKRVCKECGRSFTASAKWDY
FT                   ELCEDCSIVLYERMEKFWITEVLGLSEVLDRFLPSLPRKLFDIALKKYAPIGQYDIFDA
FT                   NSEKELQKELRGAAAVEKERLAKKVPFRTAKCKKCGTPYTVDGLWQYNICQKCAVQEVL
FT                   DWRAYWAKQVPGIGTARAGFDIPPIEVARYILD"
     MAPMDEDNIL GAINIRGQGD GMTSKNKRVC KECGRSFTAS AKWDYELCED CSIVLYERME        60
     KFWITEVLGL SEVLDRFLPS LPRKLFDIAL KKYAPIGQYD IFDANSEKEL QKELRGAAAV       120
     EKERLAKKVP FRTAKCKKCG TPYTVDGLWQ YNICQKCAVQ EVLDWRAYWA KQVPGIGTAR       180
     AGFDIPPIEV ARYILD                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page