(data stored in ACNUC10043 zone)

EMBL: AP011532.PE716

AP011532.PE716       Location/Qualifiers
FT   CDS             692833..693255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0716"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0716"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60788"
FT                   /db_xref="GOA:D1YWG6"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG6"
FT                   /protein_id="BAI60788.1"
FT                   /translation="MTGKLTDSLPLALSGLVIAGILVAFIASVMLPSRGIEASYGAADN
FT                   GKEISIGEGTTFKIILDENPTTGYSWNTTVTSGLRVENSEFIQGGNAGLAGAGGTHEWT
FT                   IKATGKGEQQFTAIYKRPWEPTTGSESAFTLKILVN"
     MTGKLTDSLP LALSGLVIAG ILVAFIASVM LPSRGIEASY GAADNGKEIS IGEGTTFKII        60
     LDENPTTGYS WNTTVTSGLR VENSEFIQGG NAGLAGAGGT HEWTIKATGK GEQQFTAIYK       120
     RPWEPTTGSE SAFTLKILVN                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page