(data stored in ACNUC10043 zone)

EMBL: AP011532.PE724

AP011532.PE724       Location/Qualifiers
FT   CDS             697310..697660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0724"
FT                   /product="putative DNA-directed RNA polymerase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0724"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60796"
FT                   /db_xref="GOA:D1YWH4"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR010924"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH4"
FT                   /protein_id="BAI60796.1"
FT                   /translation="MIIKKVISEELITLPEVRDTLNAIRDEREKAGQELRYEQKRAVEH
FT                   ANKFSKIGAKESRDMVNELLTLEKMKLDIAVKIANLCPRSKDELRAIYAKERFTLNEAE
FT                   LKAILDIVGKYI"
     MIIKKVISEE LITLPEVRDT LNAIRDEREK AGQELRYEQK RAVEHANKFS KIGAKESRDM        60
     VNELLTLEKM KLDIAVKIAN LCPRSKDELR AIYAKERFTL NEAELKAILD IVGKYI           116
//

If you have problems or comments...

PBIL Back to PBIL home page