(data stored in ACNUC10043 zone)

EMBL: AP011532.PE73

AP011532.PE73        Location/Qualifiers
FT   CDS             complement(65257..66090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Metallophosphoesterase domain
FT                   (IPR004843)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60145"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM3"
FT                   /protein_id="BAI60145.1"
FT                   /translation="MESILLFSDIHADIGALDAILRLSQSGDFVDRYGPVSLTINMGDV
FT                   LERGHGPGQVVERLESISGLESILGNHDEAFLGRIPVSGSDAESERAHEEYRATGRYES
FT                   FFRGMGKYYVNTKERLYVVHGGPIDPCAITPEGAEGIEAWLYTQPWQRISFSGERYVDA
FT                   SGYHYLPEDAFDAVRPQLGTGFLIVCGHEHEEAAYVQKGGAVENVLGKLERSTVYLGGR
FT                   EVRETKLALEEDACYLARLGMAGPEGYGEYVDDRRYFGVYSTKGGRALYLLCFGR"
     MESILLFSDI HADIGALDAI LRLSQSGDFV DRYGPVSLTI NMGDVLERGH GPGQVVERLE        60
     SISGLESILG NHDEAFLGRI PVSGSDAESE RAHEEYRATG RYESFFRGMG KYYVNTKERL       120
     YVVHGGPIDP CAITPEGAEG IEAWLYTQPW QRISFSGERY VDASGYHYLP EDAFDAVRPQ       180
     LGTGFLIVCG HEHEEAAYVQ KGGAVENVLG KLERSTVYLG GREVRETKLA LEEDACYLAR       240
     LGMAGPEGYG EYVDDRRYFG VYSTKGGRAL YLLCFGR                                277
//

If you have problems or comments...

PBIL Back to PBIL home page