(data stored in ACNUC10043 zone)

EMBL: AP011532.PE739

AP011532.PE739       Location/Qualifiers
FT   CDS             711468..712556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0739"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Radical SAM domain (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0739"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60811"
FT                   /db_xref="GOA:D1YWI9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWI9"
FT                   /protein_id="BAI60811.1"
FT                   /translation="MISGFDRLVLLGRLKVWQDRLEKERKEHRLRYLFWETTRACNLRC
FT                   RHCGSDCTVPKPGELSTGEIKAAFKSIASDYDARSIMVAVTGGEPLLRKDLFDVMGYAH
FT                   GLGFPWGMVTNGMLVDDEVIEKCGRAGMSTVTVSVDGLREAHEHIRRGGSFERTIEALK
FT                   LFKDSGRFSVVQATTCASQYNTGDLQGLYELFSRLGIDEWRLLTVTPIGRARDDPNFRL
FT                   QPGQLRSLLDFIVAKRREKGLRVTFEEEGFLGPAYEGKVRDSLFYCPAGINIASILACG
FT                   DIGACPNLPPEFIQGNVRKDRFKDVWENRYGNMRDLGWKRCGTCAGCAWWDLCRGNSLH
FT                   LWDLKNGRPIMCHLQALEEGGR"
     MISGFDRLVL LGRLKVWQDR LEKERKEHRL RYLFWETTRA CNLRCRHCGS DCTVPKPGEL        60
     STGEIKAAFK SIASDYDARS IMVAVTGGEP LLRKDLFDVM GYAHGLGFPW GMVTNGMLVD       120
     DEVIEKCGRA GMSTVTVSVD GLREAHEHIR RGGSFERTIE ALKLFKDSGR FSVVQATTCA       180
     SQYNTGDLQG LYELFSRLGI DEWRLLTVTP IGRARDDPNF RLQPGQLRSL LDFIVAKRRE       240
     KGLRVTFEEE GFLGPAYEGK VRDSLFYCPA GINIASILAC GDIGACPNLP PEFIQGNVRK       300
     DRFKDVWENR YGNMRDLGWK RCGTCAGCAW WDLCRGNSLH LWDLKNGRPI MCHLQALEEG       360
     GR                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page