(data stored in ACNUC10043 zone)

EMBL: AP011532.PE743

AP011532.PE743       Location/Qualifiers
FT   CDS             complement(713963..715585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0743"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60815"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWJ3"
FT                   /protein_id="BAI60815.1"
FT                   /translation="MRLVQAVIALILSALFLGVLAGVAAANVPGVAINAPPPPPAPNVA
FT                   TAGSDAMIKVVLTHRDTGSPALHYVDRVMLYDGNKLIKEWKYDQNSYKTDEVWTESLTV
FT                   PAKSDMHLRAVAHCTVHGYDLAGMHVRVLPAGTTPAQMMQTDAAYAGMQAFGYSKADKA
FT                   SDFVASADTRLLQDNIKARSGDLKSFQAKMSDWMKSTEGKQFIAKFEKTGAPMSAGEMA
FT                   RQAPMATKAAKPTIKRKVGTGDLSDKSSNIPRATYSPTPFVSVKPSLKAKAKTSPATKY
FT                   LAVKASVKPTMKPTTKYMTAKATVKPTKTATKYLAVKASPKPTMKPATKYLAAKAKAKP
FT                   SASMMPAKTKKTLSQYGTMALKVSPTAKPAKKPATKYLVAKATARPTKKPGMKYMLAAP
FT                   QGVKTPAESYGIYGLGGNVPSPPKATATVRPVPSGSPTPVPGFYTPRYPGEAGAGKNVT
FT                   VPPTPTPTARPAAGVAASSVSIPYTGTTGRGTIGQCGCVALASDNRYAGRGPGLVGTTI
FT                   VNPPSSAPGPNSRPTAFVIVRRR"
     MRLVQAVIAL ILSALFLGVL AGVAAANVPG VAINAPPPPP APNVATAGSD AMIKVVLTHR        60
     DTGSPALHYV DRVMLYDGNK LIKEWKYDQN SYKTDEVWTE SLTVPAKSDM HLRAVAHCTV       120
     HGYDLAGMHV RVLPAGTTPA QMMQTDAAYA GMQAFGYSKA DKASDFVASA DTRLLQDNIK       180
     ARSGDLKSFQ AKMSDWMKST EGKQFIAKFE KTGAPMSAGE MARQAPMATK AAKPTIKRKV       240
     GTGDLSDKSS NIPRATYSPT PFVSVKPSLK AKAKTSPATK YLAVKASVKP TMKPTTKYMT       300
     AKATVKPTKT ATKYLAVKAS PKPTMKPATK YLAAKAKAKP SASMMPAKTK KTLSQYGTMA       360
     LKVSPTAKPA KKPATKYLVA KATARPTKKP GMKYMLAAPQ GVKTPAESYG IYGLGGNVPS       420
     PPKATATVRP VPSGSPTPVP GFYTPRYPGE AGAGKNVTVP PTPTPTARPA AGVAASSVSI       480
     PYTGTTGRGT IGQCGCVALA SDNRYAGRGP GLVGTTIVNP PSSAPGPNSR PTAFVIVRRR       540
//

If you have problems or comments...

PBIL Back to PBIL home page