(data stored in ACNUC10043 zone)

EMBL: AP011532.PE745

AP011532.PE745       Location/Qualifiers
FT   CDS             complement(716648..718879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0745"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0745"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60817"
FT                   /db_xref="GOA:D1YWJ5"
FT                   /db_xref="InterPro:IPR018746"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWJ5"
FT                   /protein_id="BAI60817.1"
FT                   /translation="MRKEYWLALALAGILAMLPLGPLQLILLLTVPGFALLVLFKERFD
FT                   VVELAAYSFTLSILAFPLAVLIAWFLGMWHAGAVLLGLAAVSVAAIKYRRGANIELVHS
FT                   KLQWPVLGIALLIFAIVLFISLKTFTLTDAGFVCGTTHASDLNFHLSIAQRYIESPHIP
FT                   VEDPYLPGHYIVYNWFMHLLMGELGVLTGIDLFTIFHVLVPLASALIFLGAYLLALFLF
FT                   NSERDALVSSVVFIAASGLSWVYIAYQLFVLNNPSPDIFKEMVYEWPGIIQMIPGIKFT
FT                   MMLKYDPTVLFFFLPQTQTFGLLATIFGFLLFLKAIKEKSPACAAVTGLVLASLVLFHM
FT                   ITAFPVFITLGLMFLYLLLRRRFDDALVAAIPLSVAFVASIYQLAIMQQGNASQIIIAH
FT                   HPDVIPTILFSIGLFIPFAIYGMYLKRDDEPSWLLGLFAIINIVLLNVVELPATVNTYR
FT                   FLVYAALPVSLFAGLVFSRWLVSRNTLKMAAAAVVILLMVPSTLIMVGFYNDSTYVHAS
FT                   TAEYEALQWIKENTPNNAVIYEEPGFFPRVPVVTGRDVAYSGEIYTLQYHNVDLQADAY
FT                   GILSITDPAALYDKLSEYNVKYVFVGHRESTHPFITALKDARYFLPVYDRDGVNIYEVT
FT                   GIAPQEETKDMDISPMNWIAFFAALLYLLILPGFNIVRTLGWESKLNPVELVVYVFGIS
FT                   VAVLVVVATLVALTFSIGLNFYTIIVPVTLIIILTNREVVSFIRRTLKV"
     MRKEYWLALA LAGILAMLPL GPLQLILLLT VPGFALLVLF KERFDVVELA AYSFTLSILA        60
     FPLAVLIAWF LGMWHAGAVL LGLAAVSVAA IKYRRGANIE LVHSKLQWPV LGIALLIFAI       120
     VLFISLKTFT LTDAGFVCGT THASDLNFHL SIAQRYIESP HIPVEDPYLP GHYIVYNWFM       180
     HLLMGELGVL TGIDLFTIFH VLVPLASALI FLGAYLLALF LFNSERDALV SSVVFIAASG       240
     LSWVYIAYQL FVLNNPSPDI FKEMVYEWPG IIQMIPGIKF TMMLKYDPTV LFFFLPQTQT       300
     FGLLATIFGF LLFLKAIKEK SPACAAVTGL VLASLVLFHM ITAFPVFITL GLMFLYLLLR       360
     RRFDDALVAA IPLSVAFVAS IYQLAIMQQG NASQIIIAHH PDVIPTILFS IGLFIPFAIY       420
     GMYLKRDDEP SWLLGLFAII NIVLLNVVEL PATVNTYRFL VYAALPVSLF AGLVFSRWLV       480
     SRNTLKMAAA AVVILLMVPS TLIMVGFYND STYVHASTAE YEALQWIKEN TPNNAVIYEE       540
     PGFFPRVPVV TGRDVAYSGE IYTLQYHNVD LQADAYGILS ITDPAALYDK LSEYNVKYVF       600
     VGHRESTHPF ITALKDARYF LPVYDRDGVN IYEVTGIAPQ EETKDMDISP MNWIAFFAAL       660
     LYLLILPGFN IVRTLGWESK LNPVELVVYV FGISVAVLVV VATLVALTFS IGLNFYTIIV       720
     PVTLIIILTN REVVSFIRRT LKV                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page