(data stored in ACNUC10043 zone)

EMBL: AP011532.PE75

AP011532.PE75        Location/Qualifiers
FT   CDS             complement(66622..67572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two Protein of unknown function DUF6,
FT                   transmembrane domains (IPR000620)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60147"
FT                   /db_xref="GOA:D1YUM5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM5"
FT                   /protein_id="BAI60147.1"
FT                   /translation="MLKNADLRDNAFFVMAGLILVNVFWGASSIAAREALLQLSSIEIV
FT                   TIRFTIALFIVFGMAIAMKKWDALRIHPKDIPTFILLSLSNVSIGFILQVESLNYTTVT
FT                   NFSLEFNLATFFIMLMGALLLGERLTRTKLAGAGIAFAGAFLIISGGRLDLSSAHLLGD
FT                   LMGVGSAIAFGIFTIASKKVSSKYSLTTILLYTFFFGVLELLPFYAFVTPMTPLASLSP
FT                   LSWSSLLFLAVLCSVFCFFVYTHGLSRLKASDVAMSIYVTPLAGILLAVLLLGETLTAV
FT                   TAVGAGLIMAGMYLTQRELEPDVPEKRYTPVALNE"
     MLKNADLRDN AFFVMAGLIL VNVFWGASSI AAREALLQLS SIEIVTIRFT IALFIVFGMA        60
     IAMKKWDALR IHPKDIPTFI LLSLSNVSIG FILQVESLNY TTVTNFSLEF NLATFFIMLM       120
     GALLLGERLT RTKLAGAGIA FAGAFLIISG GRLDLSSAHL LGDLMGVGSA IAFGIFTIAS       180
     KKVSSKYSLT TILLYTFFFG VLELLPFYAF VTPMTPLASL SPLSWSSLLF LAVLCSVFCF       240
     FVYTHGLSRL KASDVAMSIY VTPLAGILLA VLLLGETLTA VTAVGAGLIM AGMYLTQREL       300
     EPDVPEKRYT PVALNE                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page