(data stored in ACNUC10043 zone)

EMBL: AP011532.PE78

AP011532.PE78        Location/Qualifiers
FT   CDS             complement(68955..69623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60150"
FT                   /db_xref="GOA:D1YUM8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM8"
FT                   /protein_id="BAI60150.1"
FT                   /translation="MLSLVGDVTSTVTDIISNMGYLGVFILMTIESAGIPVPSEVIMTY
FT                   GGFMAAPGGVTHVVAVAVIGSLGTGLGSAIGYLVGAWGGKPFVDKYGKFFGVNSQKMLW
FT                   AEQWFCKYGESACIYTRLLPVVRTIVNVPAGLLNMDFKKFMAYSMIGAFPWCLVLAFIG
FT                   FVLGENWESIMGASHLLSYAVVAVVAVIAVAAVALYVLVKRGVIPKATVDKYLGFLMHV
FT                   "
     MLSLVGDVTS TVTDIISNMG YLGVFILMTI ESAGIPVPSE VIMTYGGFMA APGGVTHVVA        60
     VAVIGSLGTG LGSAIGYLVG AWGGKPFVDK YGKFFGVNSQ KMLWAEQWFC KYGESACIYT       120
     RLLPVVRTIV NVPAGLLNMD FKKFMAYSMI GAFPWCLVLA FIGFVLGENW ESIMGASHLL       180
     SYAVVAVVAV IAVAAVALYV LVKRGVIPKA TVDKYLGFLM HV                          222
//

If you have problems or comments...

PBIL Back to PBIL home page