(data stored in ACNUC10043 zone)

EMBL: AP011532.PE85

AP011532.PE85        Location/Qualifiers
FT   CDS             76906..77289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60157"
FT                   /db_xref="InterPro:IPR017185"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN5"
FT                   /protein_id="BAI60157.1"
FT                   /translation="MKKLTVPVLDEKDKEFVETLVNVGLKRNVAKTLVYLANVDETISR
FT                   DIELGADLRQPEVSIVMRELRDQGWVEEREIKKEGKGRPLKCYKLATSITDIISMLEER
FT                   KKEEAAVHLENIQKLRNLSDKLK"
     MKKLTVPVLD EKDKEFVETL VNVGLKRNVA KTLVYLANVD ETISRDIELG ADLRQPEVSI        60
     VMRELRDQGW VEEREIKKEG KGRPLKCYKL ATSITDIISM LEERKKEEAA VHLENIQKLR       120
     NLSDKLK                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page