(data stored in ACNUC10043 zone)

EMBL: AP011532.PE86

AP011532.PE86        Location/Qualifiers
FT   CDS             complement(77336..78034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Predicted nucleotidyltransferase
FT                   family (IPR009185)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60158"
FT                   /db_xref="GOA:D1YUN6"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR009185"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN6"
FT                   /protein_id="BAI60158.1"
FT                   /translation="MRRKTAEMGPRKEVAYGPETWEHLRRLRERAREVLTLLKKSEVDG
FT                   YVFGSVARGDVKPASDVDIFIPSMVSSMLVGLALDDRVRERSIVQATPRAMAKAHLVLQ
FT                   DDTNVIFPLIPPRETELEFYRFGGEVGLQGIEEGGRVCGVDKRLMFIEPTPEGHIETPL
FT                   SDLPPGWVAKKIGVGQAIVEERMRVLERRADVGRTGIYLHRTLAPEESFEQVLAEIAYS
FT                   DPALRRRMSK"
     MRRKTAEMGP RKEVAYGPET WEHLRRLRER AREVLTLLKK SEVDGYVFGS VARGDVKPAS        60
     DVDIFIPSMV SSMLVGLALD DRVRERSIVQ ATPRAMAKAH LVLQDDTNVI FPLIPPRETE       120
     LEFYRFGGEV GLQGIEEGGR VCGVDKRLMF IEPTPEGHIE TPLSDLPPGW VAKKIGVGQA       180
     IVEERMRVLE RRADVGRTGI YLHRTLAPEE SFEQVLAEIA YSDPALRRRM SK               232
//

If you have problems or comments...

PBIL Back to PBIL home page