(data stored in ACNUC10043 zone)

EMBL: AP011532.PE88

AP011532.PE88        Location/Qualifiers
FT   CDS             78408..80072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0088"
FT                   /product="peptidase M50 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60160"
FT                   /db_xref="GOA:D1YUN8"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN8"
FT                   /protein_id="BAI60160.1"
FT                   /translation="MVELIWIAAFVAFALWWYIIADLEKAGILKKYNMTAIGPILMLRT
FT                   FRGQGFLDWLAKPKGLWRVVTLLGMPIVLGSMVLMLVLFIGMDFLMLANIESVPTPGPA
FT                   NAPQNIIAIPGLNQFIPFWWGWIALIVAMAVHEFGHAILAKVENIKVNSLGIILMPVPI
FT                   GAFAELDEEQMFGTKSEGKTADILGPMETKAPGEGKRKATSRQLTSILSAGVIANFFVA
FT                   FLAFALLFGPVLGSVAATTSDVIVYDVAPNSSAYDAGVRANFIVNSVGGMNVTSPEQFN
FT                   AALRSATGQSVAISGLLDNKPVSYVVPVNGTSGVYVSDIVNDDKYPAKAAGIAQNMRIV
FT                   AIDGTPIADRAAFTDYMNHTAPNQSIVLGMAYQNNTMVNTTVVLAQGPEGQSYIGIYTV
FT                   DNPLGISARSFASGYLGGLKNMPFSLTGWLRIFVLPVLQFSGDDPGFSIFQGQFSSLFH
FT                   PVGIAASFGSAVYSLSECLFWIGWLNLNVGLFNCLPMIPLDGGHVFREIVRRFLDPVIR
FT                   DPARKEKITGTIVNGFAVTLFAAILFMMLAPYIVHGI"
     MVELIWIAAF VAFALWWYII ADLEKAGILK KYNMTAIGPI LMLRTFRGQG FLDWLAKPKG        60
     LWRVVTLLGM PIVLGSMVLM LVLFIGMDFL MLANIESVPT PGPANAPQNI IAIPGLNQFI       120
     PFWWGWIALI VAMAVHEFGH AILAKVENIK VNSLGIILMP VPIGAFAELD EEQMFGTKSE       180
     GKTADILGPM ETKAPGEGKR KATSRQLTSI LSAGVIANFF VAFLAFALLF GPVLGSVAAT       240
     TSDVIVYDVA PNSSAYDAGV RANFIVNSVG GMNVTSPEQF NAALRSATGQ SVAISGLLDN       300
     KPVSYVVPVN GTSGVYVSDI VNDDKYPAKA AGIAQNMRIV AIDGTPIADR AAFTDYMNHT       360
     APNQSIVLGM AYQNNTMVNT TVVLAQGPEG QSYIGIYTVD NPLGISARSF ASGYLGGLKN       420
     MPFSLTGWLR IFVLPVLQFS GDDPGFSIFQ GQFSSLFHPV GIAASFGSAV YSLSECLFWI       480
     GWLNLNVGLF NCLPMIPLDG GHVFREIVRR FLDPVIRDPA RKEKITGTIV NGFAVTLFAA       540
     ILFMMLAPYI VHGI                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page