(data stored in ACNUC10043 zone)

EMBL: AP011532.PE93

AP011532.PE93        Location/Qualifiers
FT   CDS             complement(83133..84668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60165"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP3"
FT                   /protein_id="BAI60165.1"
FT                   /translation="MIVLTRFRRSDRGISELQGSLVLLAVILVAALVLKSAIGDNIAAA
FT                   ALDFGGFKAWGARNDVSFEENAPIVAITEPADGSRFYADRYTSISGTVRTAPGRNASLV
FT                   YFRLNGGPWKKAELAGNSWTSSSRRYLEGSYHVEAVAYDDHGDRSPEASGTFETIFRPY
FT                   PDAVLVGDDVPDTMTAGDPYAVHITYSNTGYLPWNDTAGYTLSPNGSTIALPSIGMGGA
FT                   SVQPHQGHSFELTLTAPAAGDYTIGYRMYCPEFGRFGDEFSKPVRVVSSYHDASVVSLN
FT                   MPDEMTSGETRTVTITMRNTGTAAWFASGSDPVYLAMVDGTSGDAYHFNGTSDRILMTP
FT                   GTVVRNGNDYTFTFTIKAPAAGSYYTQYRMMWSNHYLFGQIAGHTITVKAVPTPTPTPT
FT                   PTPGPTSNPPGPVSPTPTPVAQYNAHGKMTLKYYTGEEYRGPLRYYYDGPLGNHFERSS
FT                   RGASDDSSPTWDWDIGGPNGHYSIYNDVDHYSGGLQFEMDNGGNKGKVIFYKN"
     MIVLTRFRRS DRGISELQGS LVLLAVILVA ALVLKSAIGD NIAAAALDFG GFKAWGARND        60
     VSFEENAPIV AITEPADGSR FYADRYTSIS GTVRTAPGRN ASLVYFRLNG GPWKKAELAG       120
     NSWTSSSRRY LEGSYHVEAV AYDDHGDRSP EASGTFETIF RPYPDAVLVG DDVPDTMTAG       180
     DPYAVHITYS NTGYLPWNDT AGYTLSPNGS TIALPSIGMG GASVQPHQGH SFELTLTAPA       240
     AGDYTIGYRM YCPEFGRFGD EFSKPVRVVS SYHDASVVSL NMPDEMTSGE TRTVTITMRN       300
     TGTAAWFASG SDPVYLAMVD GTSGDAYHFN GTSDRILMTP GTVVRNGNDY TFTFTIKAPA       360
     AGSYYTQYRM MWSNHYLFGQ IAGHTITVKA VPTPTPTPTP TPGPTSNPPG PVSPTPTPVA       420
     QYNAHGKMTL KYYTGEEYRG PLRYYYDGPL GNHFERSSRG ASDDSSPTWD WDIGGPNGHY       480
     SIYNDVDHYS GGLQFEMDNG GNKGKVIFYK N                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page