(data stored in ACNUC10043 zone)

EMBL: AP011532.PE95

AP011532.PE95        Location/Qualifiers
FT   CDS             complement(85270..85728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60167"
FT                   /db_xref="GOA:D1YUP5"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP5"
FT                   /protein_id="BAI60167.1"
FT                   /translation="MKGKWKFMDDERGVENAVYSILMIAIVVIVALMIGSLVLSRGGQL
FT                   QVLAGTPKASLSGVLNGGASPSLLLNHESGDPLNVAQLSLSVFDDGGVQIGSITVPDTV
FT                   TPAAISSGMQTSAIQLTGMAITSGNRYTIKISDTQSKQQIGMMVLVAR"
     MKGKWKFMDD ERGVENAVYS ILMIAIVVIV ALMIGSLVLS RGGQLQVLAG TPKASLSGVL        60
     NGGASPSLLL NHESGDPLNV AQLSLSVFDD GGVQIGSITV PDTVTPAAIS SGMQTSAIQL       120
     TGMAITSGNR YTIKISDTQS KQQIGMMVLV AR                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page