(data stored in ACNUC10043 zone)

EMBL: AP011532.PE97

AP011532.PE97        Location/Qualifiers
FT   CDS             complement(86521..87009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one CMP/dCMP deaminase, zinc-binding domain
FT                   (IPR002125)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60169"
FT                   /db_xref="GOA:D1YUP7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP7"
FT                   /protein_id="BAI60169.1"
FT                   /translation="MNHERPTHDEYFMEIANVVAKRSTCLRIHVGAVIVKGGQILSTGY
FT                   NGAPHGFEHCLDIGCIREKENVAHGTRHELCRAVHAEQNAIIQAAIHGVSIEGATVYCT
FT                   HQPCILCTKMIINCKINRVVFQNGYPDEMSLKFLKQAGIDVLRMPSKEEPPEERPLSV"
     MNHERPTHDE YFMEIANVVA KRSTCLRIHV GAVIVKGGQI LSTGYNGAPH GFEHCLDIGC        60
     IREKENVAHG TRHELCRAVH AEQNAIIQAA IHGVSIEGAT VYCTHQPCIL CTKMIINCKI       120
     NRVVFQNGYP DEMSLKFLKQ AGIDVLRMPS KEEPPEERPL SV                          162
//

If you have problems or comments...

PBIL Back to PBIL home page